Биологический каталог




Биология антибиотиков животного происхождения

Автор В.Н.Кокряков

иотического пептида (АП). В фаголизосомах же нейтрофилов дефенсины однозначно участвуют в инактивации (киллинге) фагоцитированных микроорганизмов, что является одним из молекулярных факторов, обеспечивающих завершенность фагоцитоза (Пигаревский, 1978, 1988; Spitznagel, Chi, 1963).

\Л. р-ДЕФЕНСИНЫ

Первый представитель семейства р-дефенсинов был выделен из ресничного эпителия трахеи крупного рогатого скота и в литературе известен под названием трахеального антимикробного пептида

2 В. Н. Кокряков Наэввния пептидов

Структура пептидов 56

BNBD-l DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW

BNBD-2 VRNHVTCRINRGFCVPIRCPGRTRQXGTCFGPRIKCCR5W

BNBD-3 pEGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW

BNBD-4 pERVRNPQSCRWHMGVCIPFLCRVGMRQIGTCFGPRVPCCRR

BNBD-5 pEWRN PQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR

BNBD- 6 p EG VRNH VTCRIYGGFCVPI8CPGRTRQXGTCFGRP VKCCARW

BNBD-7 pEGVRNFVTCRIMRGFCVPIBCPGHRRQieTCLGPRIKCCR

BNBD-8 VRNFVTCRIHRGFCVPIKCPGHRRQIGTCLGPQIKCCR

BNBD-9 EGVRN FVTCRIMRGFCVPIRCPGHRRQIGTCLGPQIKCCR

BNBD-10 pEGVRS YLSCWGHRGICLLNRCPGRMRQIGTCLAPRVKCCR

BNBD-11 GPLSCRRHGCVCIPIRCPGPMRQIGTCFGRPVKCCRSW

BNBD-12 GPLSCGKHGeVCIPIRCPVPMRQICSTCFGRPVKCCRSW

BNBD-13 SGISGPL SCGRNGGVCIPIRCP VPHROIGTC FGRP VKCCRS W

LAP OGVRNSOSCRRMKGICVPIRCPGSHRQieTCLGAQVKCCRRK

EBD NPLSCRLHRGICVPIRCPGNLKQIGTCFTPSVKCCRWR

TAP NPVSCVRHKG1CVPIRCPGSMKQIGTCVGRAVKCCRKK

hTAP NPVSCVRNKOICVPVRCPGSMKQIOTCVGRAVKCCRKK

hBD-1 DHYNCVS SGGQCLYS ACPI FTKIQeTCYRGKAKCCK

hBD-2 TCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

mBD-1 DQYKCLQHGeFCLRSSCPSNTKLQOTCKPDKPNCCKS

Gal-1 GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYL-CCKRIW

Ga 1 - la GRKS DCFRKNGFCAFLKCPYLTLISGKCS RFHL-CCKRIW

Gal-2 LFC—KGGSCHFGGCPSHLIKVGSCFGFRS-CCKWPWNA

CHP-1 GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYL-CCKRIR

CHP-2 GRKSDCFRKNGFCAFLKCPYLTLISGLCSXFHL-CC

THP-1 GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQV-CC

Рис. 4. Первичные структуры р-дефснсинов позвоночных животных. Жирным шрифтом отмечены консервативные аминокислотные остатки.

(ТАР — tracheal antimicrobial peptide) (Daimond et al., 1991) (рис.4). Большая группа пептидов этого семейства (BNBD-l—BNBD-13) была выделена и структурно охарактеризована из нейтрофилов крупного рогатого скота (Selsted et al., 1993). Расположение цистеинов и их сочетание в образовании дисульфидных связей (1—5, 2—4, 3—6) оказались отличными от таковых для ранее охарактеризованных дефенсинов из нейтрофилов кролика, морской свинки, человека и крысы, а потому было решено выделить пептиды с подобными структурными особенностями в отдельное семейство р* -дефенсинов (Tang, Selsted, 1993). Необходимо подчеркнуть, что по своим вторичным и третичным структурам р-дефенсины, несмотря на ряд особенностей их аминокислотной последовательности и аранжировки дисульфидных связей, оказались идентичными классическим, или а-дефенси-нам (Zimmerman et al., 1995). Поэтому не случайно они обладают, как правило, несходной с а-дефенсинами антимикробной активностью (Selsted et al., 1993; Harwig et al., 1994b; Bals et al., 1998).

В 1995 г. (3-дефенсин был выделен из эпителия языка коров (Schon-wetter et al., 1995), продукция этого пептида возрастала при воспалении органа, вызванного его повреждением. Его структура оказалась гомологичной, но не идентичной ТАР и Р-дефенсинам из нейтрофилов коров, в связи с чем он был назван антимикробным пептидом языка (LAP — lingual antimicrobial peptide). Авторы показали, что мРНК этого пептида обнаруживается в эпителиях кожи лица, респираторного (трахеи, бронхов, легких) и репродуктивного трактов самцов и самок, мочеполовой и пищеварительной системах.

В настоящее время молекулярно-генетическими методами выявлены, выделены и охарактеризованы гены, ответственные за индуцибе-льный синтез энтеральных дефенсинов (EBD) эпителия тонкой кишки коров, которые хотя и относятся к Р-семейству, но по своей первичной структуре отличны от ранее описанных дефенсинов из нейтрофилов (Tarver et al., 1998). Картину разнообразия структур дефенсинов и особенностей их продукции в различных клеточно-ткане-вых структурах у крупного рогатого скота дополняют последние данные о конститутивном синтезе BNBD-4 и BNBD-5 в альвеолярных макрофагах (Ryan et al., 1998). Методом полимеразной цепной реакции выявлена экспрессия гена Р-дефенсина в эпителиальных клетках тонкой кишки (Tarver et al., 1998), легких и мочеполового тракта (Bals et al., 1998) мыши, а молекулярно-генетическими методами — присутствие генов р-дефенсинов в клетках свиньи (Zang et al., 1998) и овцы (Huttner et al., 1998).

Структурно-родственные Р-дефенсинам коров пептиды были выделены и секвенированы нами совместно с американскими исследователями из псевдоэозинофилов (клетки структурно и функционально гомологичные нейтрофилам млекопитающих) кур Gallus gallus (Harwig et al., 1994a, 1994b).

Первые сведения об антимикробных пептидах гетерофилов кур были получены еще в 70-е годы (Brune, Spitznagel, 1973). Было установлено, что в их гранулярном аппарате содержится по меньшей мере три низкомолекулярных оснбвных пептида, инактивирующих в условиях in vitro, — Escherichia coli, Serratia marcescens и Staphylococcus albus. Первичная структура этих пептидов оставалась нерасшифрованной. Мы заинтересовались данной группой веществ в процессе изучения резистентности кур породы Бройлер-6 к инфекции и зависимости ее от белкового спектра псевдоэозинофилов. В совместных исследованиях с сотрудниками Всесоюзного научно-исследовательского института ветеринарного птицеводства (Колабская и др., 1983) нами была установлена интересная закономерность во взаимодействии хозяин—паразит: резистентность кур к кишечной инфекции находилась в прямой зависимости от содержания в их гетерофилах де-фенсиноподобных пептидов. Группы животных с дефицитом рассматриваемых веществ характеризовались сниженной резистентностью к инфекции, в этих партиях наблюдался максимальный падеж птицы. Нами совместно с американскими коллегами было осуществлено выделение и изучение структурно-функциональных св

страница 7
< К СПИСКУ КНИГ > 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74

Скачать книгу "Биология антибиотиков животного происхождения" (3.25Mb)


[каталог]  [статьи]  [доска объявлений]  [обратная связь]

п»ї
Rambler's Top100 Химический каталог

Copyright © 2009
(23.08.2017)